SCOPe 2.08: Domain d3eeub_: 3eeu B:

Lineage for d3eeub_ (3eeu B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.0: automated matches [191580] (1 protein)
   not a true family

6. Protein automated matches [191036] (17 species)
   not a true protein

7. Species Bdellovibrio bacteriovorus [TaxId:959] [225632] (4 PDB entries)

8. Domain d3eeub_: 3eeu B: [209471]
   automated match to d3gwyb_
   protein/RNA complex; complexed with act, cl, ho

Details for d3eeub_

PDB Entry: 3eeu, 2 Å

PDB Description: structure of the rna pyrophosphohydrolase bdrpph in complex with holmium

PDB Compounds: (B:) Probable pyrophosphohydrolase

SCOPe Domain Sequences for d3eeub_:

Sequence, based on SEQRES records:

>d3eeub_ d.113.1.0 (B:) automated matches {Bdellovibrio bacteriovorus [TaxId: 959]}
kghwipvvagflrkdgkilvgqrpennslagqwefpggkiengetpeealarelneelgi
eaevgelklacthsygdvgililfyeilywkgeprakhhmmlewihpeelkhrnipeanr
kilhkiykalglew

Sequence, based on observed residues (ATOM records):

>d3eeub_ d.113.1.0 (B:) automated matches {Bdellovibrio bacteriovorus [TaxId: 959]}
kghwipvvagflrkdgkilvgqrpegqwefpggkiengetpeealarelneelgieaevg
elklacthsygdvgililfyeilywkgeprakhhmmlewihpeelkhrnipeanrkilhk
iykalglew

Timeline for d3eeub_:

• d3eeub_ first appeared in SCOPe 2.03
  
• d3eeub_ appears in SCOPe 2.07