SCOP 1.67: Domain d2f19h2: 2f19 H:124-221

Lineage for d2f19h2 (2f19 H:124-221)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)

8. Domain d2f19h2: 2f19 H:124-221 [20947]
   Other proteins in same PDB: d2f19h1, d2f19l1, d2f19l2
   part of Fab R19.9

Details for d2f19h2

PDB Entry: 2f19, 2.8 Å

PDB Description: three-dimensional structure of two crystal forms of fab r19.9, from a monoclonal anti-arsonate antibody

SCOP Domain Sequences for d2f19h2:

Sequence; same for both SEQRES and ATOM records:

>d2f19h2 b.1.1.2 (H:124-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
sakttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqs
alytmsssvtvpsstwpsqtvtcsvahpassttvdkkl

Timeline for d2f19h2:

• d2f19h2 first appeared (with stable ids) in SCOP 1.55
  
• d2f19h2 appears in SCOP 1.65
  
• d2f19h2 appears in SCOP 1.69
  
• d2f19h2 appears in the current release, SCOPe 2.08