Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) |
Family c.33.1.0: automated matches [191389] (1 protein) not a true family |
Protein automated matches [190499] (26 species) not a true protein |
Species Thermoplasma acidophilum [TaxId:2303] [225522] (1 PDB entry) |
Domain d3eefb_: 3eef B: [209467] automated match to d1j2ra_ complexed with zn |
PDB Entry: 3eef (more details), 2.35 Å
SCOPe Domain Sequences for d3eefb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eefb_ c.33.1.0 (B:) automated matches {Thermoplasma acidophilum [TaxId: 2303]} mkpalvvvdmvnefihgrlatpeamktvgparkvietfrrsglpvvyvndshypddpeir iwgrhsmkgddgsevideirpsagdyvlekhaysgfygtnldmilrangidtvvliglda dicvrhtaadalyrnyriivvedavaaridpnwkdyftrvygatvkrsdeieg
Timeline for d3eefb_: