Lineage for d2f19l2 (2f19 L:109-214)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159982Species Fab R19.9 (mouse), kappa L chain [48987] (2 PDB entries)
  8. 159986Domain d2f19l2: 2f19 L:109-214 [20946]
    Other proteins in same PDB: d2f19h1, d2f19l1

Details for d2f19l2

PDB Entry: 2f19 (more details), 2.8 Å

PDB Description: three-dimensional structure of two crystal forms of fab r19.9, from a monoclonal anti-arsonate antibody

SCOP Domain Sequences for d2f19l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f19l2 b.1.1.2 (L:109-214) Immunoglobulin (constant domains of L and H chains) {Fab R19.9 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d2f19l2:

Click to download the PDB-style file with coordinates for d2f19l2.
(The format of our PDB-style files is described here.)

Timeline for d2f19l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f19l1