Class b: All beta proteins [48724] (177 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
Protein automated matches [191182] (16 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225535] (1 PDB entry) |
Domain d3ecya_: 3ecy A: [209458] automated match to d1sixa_ |
PDB Entry: 3ecy (more details), 1.88 Å
SCOPe Domain Sequences for d3ecya_:
Sequence, based on SEQRES records: (download)
>d3ecya_ b.85.4.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} tcvlrfakltenalepvrgsakaagvdlrsaydvvvpargkaivktdlqvqvpegsygrv aprsglavknfidvgagvvdedyrgnlgvvlfnhsdvdfevkhgdriaqficerifypql vmvdkl
>d3ecya_ b.85.4.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} tcvlrfakltenalepvrgsakaagvdlrsaydvvvpargkaivktdlqvqvpegsygrv aprfidvgagvvdedyrgnlgvvlfnhsdvdfevkhgdriaqficerifypqlvmvdkl
Timeline for d3ecya_: