SCOPe 2.05: Domain d3ea6a2: 3ea6 A:87-217

Lineage for d3ea6a2 (3ea6 A:87-217)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein automated matches [226944] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225595] (2 PDB entries)

8. Domain d3ea6a2: 3ea6 A:87-217 [209446]
   Other proteins in same PDB: d3ea6a1
   automated match to d2g9hd2
   complexed with iod, zn

Details for d3ea6a2

PDB Entry: 3ea6, 0.92 Å

PDB Description: Atomic resolution of crystal structure of SEK

PDB Compounds: (A:) Staphylococcal enterotoxin K

SCOPe Domain Sequences for d3ea6a2:

Sequence; same for both SEQRES and ATOM records:

>d3ea6a2 d.15.6.1 (A:87-217) automated matches {Staphylococcus aureus [TaxId: 1280]}
eyldksrnipiniwingnhktistnkvstnkkfvtaqeidvklrkylqeeyniyghngtk
kgeeyghkskfysgfnigkvtfhlnnndtfsydlfytgddglpksflkiyednktvesek
fhldvdisyke

Timeline for d3ea6a2:

• d3ea6a2 first appeared in SCOPe 2.03
  
• d3ea6a2 appears in SCOPe 2.04
  
• d3ea6a2 appears in SCOPe 2.06
  
• d3ea6a2 appears in the current release, SCOPe 2.08