Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
Protein automated matches [226944] (2 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [225595] (2 PDB entries) |
Domain d3ea6a2: 3ea6 A:87-217 [209446] Other proteins in same PDB: d3ea6a1 automated match to d2g9hd2 complexed with iod, zn |
PDB Entry: 3ea6 (more details), 0.92 Å
SCOPe Domain Sequences for d3ea6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ea6a2 d.15.6.1 (A:87-217) automated matches {Staphylococcus aureus [TaxId: 1280]} eyldksrnipiniwingnhktistnkvstnkkfvtaqeidvklrkylqeeyniyghngtk kgeeyghkskfysgfnigkvtfhlnnndtfsydlfytgddglpksflkiyednktvesek fhldvdisyke
Timeline for d3ea6a2: