SCOPe 2.07: Domain d3ea6a1: 3ea6 A:3-86

Lineage for d3ea6a1 (3ea6 A:3-86)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.0: automated matches [227133] (1 protein)
   not a true family

6. Protein automated matches [226834] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225054] (10 PDB entries)

8. Domain d3ea6a1: 3ea6 A:3-86 [209445]
   Other proteins in same PDB: d3ea6a2
   automated match to d2g9hd1
   complexed with iod, zn

Details for d3ea6a1

PDB Entry: 3ea6, 0.92 Å

PDB Description: Atomic resolution of crystal structure of SEK

PDB Compounds: (A:) Staphylococcal enterotoxin K

SCOPe Domain Sequences for d3ea6a1:

Sequence; same for both SEQRES and ATOM records:

>d3ea6a1 b.40.2.0 (A:3-86) automated matches {Staphylococcus aureus [TaxId: 1280]}
digidnlrnfytkkdfvdlkdvkdndtpianqlqfsnesydliseskdfnkfsnfkgkkl
dvfgisyngqcntkyiyggvtatn

Timeline for d3ea6a1:

• d3ea6a1 first appeared in SCOPe 2.03
  
• d3ea6a1 appears in SCOPe 2.06
  
• d3ea6a1 appears in the current release, SCOPe 2.08