Lineage for d3ea6a1 (3ea6 A:3-86)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1313712Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1314466Family b.40.2.0: automated matches [227133] (1 protein)
    not a true family
  6. 1314467Protein automated matches [226834] (4 species)
    not a true protein
  7. 1314468Species Staphylococcus aureus [TaxId:1280] [225054] (6 PDB entries)
  8. 1314469Domain d3ea6a1: 3ea6 A:3-86 [209445]
    Other proteins in same PDB: d3ea6a2
    automated match to d2g9hd1
    complexed with iod, zn

Details for d3ea6a1

PDB Entry: 3ea6 (more details), 0.92 Å

PDB Description: Atomic resolution of crystal structure of SEK
PDB Compounds: (A:) Staphylococcal enterotoxin K

SCOPe Domain Sequences for d3ea6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ea6a1 b.40.2.0 (A:3-86) automated matches {Staphylococcus aureus [TaxId: 1280]}
digidnlrnfytkkdfvdlkdvkdndtpianqlqfsnesydliseskdfnkfsnfkgkkl
dvfgisyngqcntkyiyggvtatn

SCOPe Domain Coordinates for d3ea6a1:

Click to download the PDB-style file with coordinates for d3ea6a1.
(The format of our PDB-style files is described here.)

Timeline for d3ea6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ea6a2