Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.0: automated matches [227133] (1 protein) not a true family |
Protein automated matches [226834] (6 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [225054] (10 PDB entries) |
Domain d3ea6a1: 3ea6 A:3-86 [209445] Other proteins in same PDB: d3ea6a2 automated match to d2g9hd1 complexed with iod, zn |
PDB Entry: 3ea6 (more details), 0.92 Å
SCOPe Domain Sequences for d3ea6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ea6a1 b.40.2.0 (A:3-86) automated matches {Staphylococcus aureus [TaxId: 1280]} digidnlrnfytkkdfvdlkdvkdndtpianqlqfsnesydliseskdfnkfsnfkgkkl dvfgisyngqcntkyiyggvtatn
Timeline for d3ea6a1: