Lineage for d1inel2 (1ine L:110-212)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221409Species Fab Cha255 (mouse), lambda L chain [48986] (2 PDB entries)
  8. 221413Domain d1inel2: 1ine L:110-212 [20944]
    Other proteins in same PDB: d1ineh1, d1inel1

Details for d1inel2

PDB Entry: 1ine (more details), 2.8 Å

PDB Description: how the anti-(metal chelate) antibody cha255 is specific for the metal ion of its antigen: x-ray structures for two fab'(slash)hapten complexes with different metals in the chelate

SCOP Domain Sequences for d1inel2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1inel2 b.1.1.2 (L:110-212) Immunoglobulin (constant domains of L and H chains) {Fab Cha255 (mouse), lambda L chain}
gqpksspsvtlfppsseeletnkatlvctiidfypgvvtvdwkvdgtpvtqgmettqpsk
qsnnkymassyltltarewerhssyscqvtheghtvekslsra

SCOP Domain Coordinates for d1inel2:

Click to download the PDB-style file with coordinates for d1inel2.
(The format of our PDB-style files is described here.)

Timeline for d1inel2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1inel1