Lineage for d1indl2 (1ind L:110-212)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2360924Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 2361010Species Mouse (Mus musculus) [TaxId:10090] [88571] (22 PDB entries)
    Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)
  8. 2361019Domain d1indl2: 1ind L:110-212 [20942]
    Other proteins in same PDB: d1indh1, d1indh2, d1indl1
    part of Fab Cha255
    complexed with eot, in

Details for d1indl2

PDB Entry: 1ind (more details), 2.2 Å

PDB Description: how the anti-(metal chelate) antibody cha255 is specific for the metal ion of its antigen: x-ray structures for two fab'(slash)hapten complexes with different metals in the chelate
PDB Compounds: (L:) igg1-lambda cha255 fab (light chain)

SCOPe Domain Sequences for d1indl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1indl2 b.1.1.2 (L:110-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
gqpksspsvtlfppsseeletnkatlvctiidfypgvvtvdwkvdgtpvtqgmettqpsk
qsnnkymassyltltarewerhssyscqvtheghtvekslsra

SCOPe Domain Coordinates for d1indl2:

Click to download the PDB-style file with coordinates for d1indl2.
(The format of our PDB-style files is described here.)

Timeline for d1indl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1indl1