Lineage for d1indl2 (1ind L:110-212)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104112Species Fab Cha255 (mouse), lambda L chain [48986] (2 PDB entries)
  8. 104114Domain d1indl2: 1ind L:110-212 [20942]
    Other proteins in same PDB: d1indh1, d1indl1

Details for d1indl2

PDB Entry: 1ind (more details), 2.2 Å

PDB Description: how the anti-(metal chelate) antibody cha255 is specific for the metal ion of its antigen: x-ray structures for two fab'(slash)hapten complexes with different metals in the chelate

SCOP Domain Sequences for d1indl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1indl2 b.1.1.2 (L:110-212) Immunoglobulin (constant domains of L and H chains) {Fab Cha255 (mouse), lambda L chain}
gqpksspsvtlfppsseeletnkatlvctiidfypgvvtvdwkvdgtpvtqgmettqpsk
qsnnkymassyltltarewerhssyscqvtheghtvekslsra

SCOP Domain Coordinates for d1indl2:

Click to download the PDB-style file with coordinates for d1indl2.
(The format of our PDB-style files is described here.)

Timeline for d1indl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1indl1