Lineage for d3e77c1 (3e77 C:17-369)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2504859Species Human (Homo sapiens) [TaxId:9606] [188446] (29 PDB entries)
  8. 2504889Domain d3e77c1: 3e77 C:17-369 [209410]
    Other proteins in same PDB: d3e77a2, d3e77b2, d3e77c2
    automated match to d3qboa_
    complexed with gol, plp

Details for d3e77c1

PDB Entry: 3e77 (more details), 2.5 Å

PDB Description: Human phosphoserine aminotransferase in complex with PLP
PDB Compounds: (C:) phosphoserine aminotransferase

SCOPe Domain Sequences for d3e77c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e77c1 c.67.1.0 (C:17-369) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lphsvlleiqkelldykgvgisvlemshrssdfakiinntenlvrellavpdnykviflq
gggcgqfsavplnliglkagrcadyvvtgawsakaaeeakkfgtinivhpklgsytkipd
pstwnlnpdasyvyycanetvhgvefdfipdvkgavlvcdmssnflskpvdvskfgvifa
gaqknvgsagvtvvivrddllgfalrecpsvleykvqagnsslyntppcfsiyvmglvle
wiknnggaaameklssiksqtiyeiidnsqgfyvcpvepqnrskmnipfrignakgddal
ekrfldkalelnmlslkghrsvggiraslynavtiedvqklaafmkkflemhq

SCOPe Domain Coordinates for d3e77c1:

Click to download the PDB-style file with coordinates for d3e77c1.
(The format of our PDB-style files is described here.)

Timeline for d3e77c1: