Lineage for d1qlrd2 (1qlr D:121-225)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221578Species Fab Kau cold agglutinin (human) IgM, kappa L chain [48985] (2 PDB entries)
  8. 221586Domain d1qlrd2: 1qlr D:121-225 [20941]
    Other proteins in same PDB: d1qlra1, d1qlrb1, d1qlrc1, d1qlrd1
    complexed with fuc, nag

Details for d1qlrd2

PDB Entry: 1qlr (more details), 2.83 Å

PDB Description: crystal structure of the fab fragment of a human monoclonal igm cold agglutinin

SCOP Domain Sequences for d1qlrd2:

Sequence, based on SEQRES records: (download)

>d1qlrd2 b.1.1.2 (D:121-225) Immunoglobulin (constant domains of L and H chains) {Fab Kau cold agglutinin (human) IgM, kappa L chain}
gsasaptlfplvscenspsdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvl
rggkyaatsqvllpskdvmqgtdehvvckvqhpngnkeknvplpv

Sequence, based on observed residues (ATOM records): (download)

>d1qlrd2 b.1.1.2 (D:121-225) Immunoglobulin (constant domains of L and H chains) {Fab Kau cold agglutinin (human) IgM, kappa L chain}
gsasaptlfplvscvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkyaats
qvllptdehvvckvqhpngnkeknvplpv

SCOP Domain Coordinates for d1qlrd2:

Click to download the PDB-style file with coordinates for d1qlrd2.
(The format of our PDB-style files is described here.)

Timeline for d1qlrd2: