SCOPe 2.03: Domain d3e60b1: 3e60 B:1-259

Lineage for d3e60b1 (3e60 B:1-259)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (40 species)
   not a true protein

7. Species Bartonella henselae [TaxId:38323] [225508] (1 PDB entry)

8. Domain d3e60b1: 3e60 B:1-259 [209398]
   automated match to d1j3na1
   complexed with k

Details for d3e60b1

PDB Entry: 3e60, 1.95 Å

PDB Description: crystal structure of 3-oxoacyl-(acyl carrier protein) synthase ii from bartonella henselae

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein ] synthase II

SCOPe Domain Sequences for d3e60b1:

Sequence; same for both SEQRES and ATOM records:

>d3e60b1 c.95.1.0 (B:1-259) automated matches {Bartonella henselae [TaxId: 38323]}
mrrvvitglglvsplagdveyswkrllegksgvrritefdvsdlscqiaaripvgdgtng
tynadlhmeskeqrkvdafivyaiaaadqaladaewfpksdedqictgvligsgiggieg
iveagytlrdkgprrispffipgrlinlasgyvsikyglrgpnhsvvtacstgahaigda
arlialgdadvmlaggtespinrislagfsacralstcrnddperasrpydvdrdgfvmg
egaaivvleelehakkrga

Timeline for d3e60b1:

• d3e60b1 is new in SCOPe 2.03-stable
  
• d3e60b1 appears in SCOPe 2.04
  
• d3e60b1 appears in the current release, SCOPe 2.08