SCOP 1.73: Domain d1qlrb2: 1qlr B:121-225

Lineage for d1qlrb2 (1qlr B:121-225)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88583] (5 PDB entries)

8. Domain d1qlrb2: 1qlr B:121-225 [20939]
   Other proteins in same PDB: d1qlra1, d1qlra2, d1qlrb1, d1qlrc1, d1qlrc2, d1qlrd1

Details for d1qlrb2

PDB Entry: 1qlr, 2.83 Å

PDB Description: crystal structure of the fab fragment of a human monoclonal igm cold agglutinin

PDB Compounds: (B:) igm fab region IV-j(h4)-c (kau cold agglutinin)

SCOP Domain Sequences for d1qlrb2:

Sequence, based on SEQRES records:

>d1qlrb2 b.1.1.2 (B:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]}
gsasaptlfplvscenspsdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvl
rggkyaatsqvllpskdvmqgtdehvvckvqhpngnkeknvplpv

Sequence, based on observed residues (ATOM records):

>d1qlrb2 b.1.1.2 (B:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]}
gsasaptlfplvscvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkyaats
qvllptdehvvckvqhpngnkeknvplpv

Timeline for d1qlrb2:

• d1qlrb2 first appeared (with stable ids) in SCOP 1.55
  
• d1qlrb2 appears in SCOP 1.71
  
• d1qlrb2 appears in SCOP 1.75
  
• d1qlrb2 appears in the current release, SCOPe 2.08