Lineage for d3e5na2 (3e5n A:140-360)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217269Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2217671Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2217672Protein automated matches [226904] (32 species)
    not a true protein
  7. 2217811Species Xanthomonas oryzae [TaxId:342109] [225705] (4 PDB entries)
  8. 2217812Domain d3e5na2: 3e5n A:140-360 [209387]
    Other proteins in same PDB: d3e5na1
    automated match to d1ehib2

Details for d3e5na2

PDB Entry: 3e5n (more details), 2 Å

PDB Description: Crystal strucutre of D-alanine-D-alanine ligase from Xanthomonas oryzae pv. oryzae KACC10331
PDB Compounds: (A:) D-alanine-D-alanine ligase A

SCOPe Domain Sequences for d3e5na2:

Sequence, based on SEQRES records: (download)

>d3e5na2 d.142.1.0 (A:140-360) automated matches {Xanthomonas oryzae [TaxId: 342109]}
dkdmakrvlrdarlavapfvcfdrhtaahadvdtliaqlglplfvkpanqgssvgvsqvr
tadafaaalalalaydhkvlveaavagreiecavlgnavphasvcgevvvhdafysyatk
yisehgaeivipadidaqtqqriqqiavqayqalgcagmarvdvflcadgrivinevntl
pgftrisvypklwqasgldyrglitrlielalerhtddqll

Sequence, based on observed residues (ATOM records): (download)

>d3e5na2 d.142.1.0 (A:140-360) automated matches {Xanthomonas oryzae [TaxId: 342109]}
dkdmakrvlrdarlavapfvcfdrhtaahadvdtliaqlglplfvkpanqgssvgvsqvr
tadafaaalalalaydhkvlveaavagreiecavlgnavphasvcgevvveivipadida
qtqqriqqiavqayqalgcagmarvdvflcadgrivinevntlpgftrisvypklwqasg
ldyrglitrlielalerhtddqll

SCOPe Domain Coordinates for d3e5na2:

Click to download the PDB-style file with coordinates for d3e5na2.
(The format of our PDB-style files is described here.)

Timeline for d3e5na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3e5na1