Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) |
Species Fab Kau cold agglutinin (human) IgM, kappa L chain [48985] (2 PDB entries) |
Domain d1qlra2: 1qlr A:108-214 [20938] Other proteins in same PDB: d1qlra1, d1qlrb1, d1qlrc1, d1qlrd1 |
PDB Entry: 1qlr (more details), 2.83 Å
SCOP Domain Sequences for d1qlra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qlra2 b.1.1.2 (A:108-214) Immunoglobulin (constant domains of L and H chains) {Fab Kau cold agglutinin (human) IgM, kappa L chain} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d1qlra2: