Lineage for d1dn0d2 (1dn0 D:121-225)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453906Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species)
  7. 453907Species Human (Homo sapiens) [TaxId:9606] [88583] (5 PDB entries)
  8. 453909Domain d1dn0d2: 1dn0 D:121-225 [20937]
    Other proteins in same PDB: d1dn0a1, d1dn0a2, d1dn0b1, d1dn0c1, d1dn0c2, d1dn0d1
    part of Fab Kau cold agglutinin IgM

Details for d1dn0d2

PDB Entry: 1dn0 (more details), 2.28 Å

PDB Description: structure of the fab fragment from a human igm cold agglutinin

SCOP Domain Sequences for d1dn0d2:

Sequence, based on SEQRES records: (download)

>d1dn0d2 b.1.1.2 (D:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens)}
gsasaptlfplvscenspsdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvl
rggkyaatsqvllpskdvmagtdehvvckvqhpngnkeknvplpv

Sequence, based on observed residues (ATOM records): (download)

>d1dn0d2 b.1.1.2 (D:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens)}
gsasaptlfplvscsvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkyaat
sqvllpskdvmagtdehvvckvqhpngnkeknvplpv

SCOP Domain Coordinates for d1dn0d2:

Click to download the PDB-style file with coordinates for d1dn0d2.
(The format of our PDB-style files is described here.)

Timeline for d1dn0d2: