SCOP 1.71: Domain d1dn0b2: 1dn0 B:121-225

Lineage for d1dn0b2 (1dn0 B:121-225)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88583] (5 PDB entries)

8. Domain d1dn0b2: 1dn0 B:121-225 [20935]
   Other proteins in same PDB: d1dn0a1, d1dn0a2, d1dn0b1, d1dn0c1, d1dn0c2, d1dn0d1

Details for d1dn0b2

PDB Entry: 1dn0, 2.28 Å

PDB Description: structure of the fab fragment from a human igm cold agglutinin

SCOP Domain Sequences for d1dn0b2:

Sequence, based on SEQRES records:

>d1dn0b2 b.1.1.2 (B:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens)}
gsasaptlfplvscenspsdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvl
rggkyaatsqvllpskdvmagtdehvvckvqhpngnkeknvplpv

Sequence, based on observed residues (ATOM records):

>d1dn0b2 b.1.1.2 (B:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens)}
gsasaptlfplvsctssvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkya
atsqvllpskdvtdehvvckvqhpngnkeknvplpv

Timeline for d1dn0b2:

• d1dn0b2 first appeared (with stable ids) in SCOP 1.55
  
• d1dn0b2 appears in SCOP 1.69
  
• d1dn0b2 appears in SCOP 1.73
  
• d1dn0b2 appears in the current release, SCOPe 2.08