SCOP 1.65: Domain d1dn0b2: 1dn0 B:121-225

Lineage for d1dn0b2 (1dn0 B:121-225)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [88583] (5 PDB entries)
Domain d1dn0b2: 1dn0 B:121-225 [20935]
Other proteins in same PDB: d1dn0a1, d1dn0a2, d1dn0b1, d1dn0c1, d1dn0c2, d1dn0d1

Details for d1dn0b2

PDB Entry: 1dn0 (more details), 2.28 Å

PDB Description: structure of the fab fragment from a human igm cold agglutinin

SCOP Domain Sequences for d1dn0b2:

Sequence, based on SEQRES records: (download)

>d1dn0b2 b.1.1.2 (B:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens)}
gsasaptlfplvscenspsdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvl
rggkyaatsqvllpskdvmagtdehvvckvqhpngnkeknvplpv

Sequence, based on observed residues (ATOM records): (download)

>d1dn0b2 b.1.1.2 (B:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens)}
gsasaptlfplvsctssvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkya
atsqvllpskdvtdehvvckvqhpngnkeknvplpv

SCOP Domain Coordinates for d1dn0b2:

Click to download the PDB-style file with coordinates for d1dn0b2.
(The format of our PDB-style files is described here.)

Timeline for d1dn0b2: