Lineage for d1dn0b2 (1dn0 B:121-225)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104277Species Fab Kau cold agglutinin (human) IgM, kappa L chain [48985] (2 PDB entries)
  8. 104279Domain d1dn0b2: 1dn0 B:121-225 [20935]
    Other proteins in same PDB: d1dn0a1, d1dn0b1, d1dn0c1, d1dn0d1

Details for d1dn0b2

PDB Entry: 1dn0 (more details), 2.28 Å

PDB Description: structure of the fab fragment from a human igm cold agglutinin

SCOP Domain Sequences for d1dn0b2:

Sequence, based on SEQRES records: (download)

>d1dn0b2 b.1.1.2 (B:121-225) Immunoglobulin (constant domains of L and H chains) {Fab Kau cold agglutinin (human) IgM, kappa L chain}
gsasaptlfplvscenspsdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvl
rggkyaatsqvllpskdvmagtdehvvckvqhpngnkeknvplpv

Sequence, based on observed residues (ATOM records): (download)

>d1dn0b2 b.1.1.2 (B:121-225) Immunoglobulin (constant domains of L and H chains) {Fab Kau cold agglutinin (human) IgM, kappa L chain}
gsasaptlfplvsctssvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkya
atsqvllpskdvtdehvvckvqhpngnkeknvplpv

SCOP Domain Coordinates for d1dn0b2:

Click to download the PDB-style file with coordinates for d1dn0b2.
(The format of our PDB-style files is described here.)

Timeline for d1dn0b2: