SCOPe 2.03: Domain d3dx9c1: 3dx9 C:2-125

Lineage for d3dx9c1 (3dx9 C:2-125)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (16 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188740] (75 PDB entries)
Domain d3dx9c1: 3dx9 C:2-125 [209348]
Other proteins in same PDB: d3dx9a2, d3dx9b1, d3dx9b2, d3dx9c2, d3dx9d1, d3dx9d2
automated match to d2esvd1

Details for d3dx9c1

PDB Entry: 3dx9 (more details), 2.75 Å

PDB Description: Crystal Structure of the DM1 TCR at 2.75A

PDB Compounds: (C:) DM1 T cell receptor alpha chain

SCOPe Domain Sequences for d3dx9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dx9c1 b.1.1.1 (C:2-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akttqptsmdcaegraanlpcnhstisgneyvywyrqihsqgpqyiihglknnetnemas
liitedrksstlilphatlrdtavyycivwggyqkvtfgtgtklqvip

SCOPe Domain Coordinates for d3dx9c1:

Click to download the PDB-style file with coordinates for d3dx9c1.
(The format of our PDB-style files is described here.)

Timeline for d3dx9c1: