Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries) |
Domain d3dx9b1: 3dx9 B:2-129 [209346] Other proteins in same PDB: d3dx9a1, d3dx9a2, d3dx9b2, d3dx9c1, d3dx9c2, d3dx9d2 automated match to d1qrne1 |
PDB Entry: 3dx9 (more details), 2.75 Å
SCOPe Domain Sequences for d3dx9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dx9b1 b.1.1.0 (B:2-129) automated matches {Human (Homo sapiens) [TaxId: 9606]} tgvsqnprhkitkrgqnvtfrcdpisehnrlywyrqtlgqgpefltyfqneaqleksrll sdrfsaerpkgsfstleiqrteqgdsamylcasryrddsyneqffgpgtrltvled
Timeline for d3dx9b1: