Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) |
Species Fab 26-10 (mouse), kappa L chain [48984] (2 PDB entries) |
Domain d1igjd2: 1igj D:115-227 [20931] Other proteins in same PDB: d1igja1, d1igjb1, d1igjc1, d1igjd1 |
PDB Entry: 1igj (more details), 2.5 Å
SCOP Domain Sequences for d1igjd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igjd2 b.1.1.2 (D:115-227) Immunoglobulin (constant domains of L and H chains) {Fab 26-10 (mouse), kappa L chain} kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
Timeline for d1igjd2: