Lineage for d3dsea_ (3dse A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660634Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1660635Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1660932Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (2 proteins)
  6. 1660933Protein Botulinum neurotoxin [55513] (4 species)
  7. 1660934Species Clostridium botulinum, serotype A [TaxId:1491] [55514] (25 PDB entries)
    Uniprot P10845 1-419
  8. 1660948Domain d3dsea_: 3dse A: [209289]
    automated match to d3ds9a_
    complexed with ni, zn

Details for d3dsea_

PDB Entry: 3dse (more details), 1.9 Å

PDB Description: A potent peptidomimetic inhibitor of botulinum neurotoxin serotype A has a very different conformation than SNAP-25 substrate
PDB Compounds: (A:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d3dsea_:

Sequence, based on SEQRES records: (download)

>d3dsea_ d.92.1.7 (A:) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
pfvnkqfnykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdlnp
ppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggs
tidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngyg
stqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahelihaghrlygiainpnr
vfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnkak
sivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkvl
nrktylnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklk

Sequence, based on observed residues (ATOM records): (download)

>d3dsea_ d.92.1.7 (A:) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
pfvnkqfnykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdlnp
ppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggs
tidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngyg
stqyirfspdftfgfeegagkfatdpavtlahelihaghrlygiainpnrvfkevsfeel
rtfgghdakfidslqenefrlyyynkfkdiastlnkaksivgttaslqymknvfkekyll
sedtsgkfsvdklkfdklykmlteiytednfvkffkvlnrktylnfdkavfkinivpkvn
ytiydgfnlrntnlaanfngqnteinnmnftklk

SCOPe Domain Coordinates for d3dsea_:

Click to download the PDB-style file with coordinates for d3dsea_.
(The format of our PDB-style files is described here.)

Timeline for d3dsea_: