Lineage for d1igja2 (1igj A:108-211)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53504Species Fab 26-10 (mouse), kappa L chain [48984] (2 PDB entries)
  8. 53505Domain d1igja2: 1igj A:108-211 [20928]
    Other proteins in same PDB: d1igja1, d1igjb1, d1igjc1, d1igjd1

Details for d1igja2

PDB Entry: 1igj (more details), 2.5 Å

PDB Description: 26-10 fab:digoxin complex-affinity and specificity due to surface complementarity

SCOP Domain Sequences for d1igja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igja2 b.1.1.2 (A:108-211) Immunoglobulin (constant domains of L and H chains) {Fab 26-10 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1igja2:

Click to download the PDB-style file with coordinates for d1igja2.
(The format of our PDB-style files is described here.)

Timeline for d1igja2: