SCOPe 2.07: Domain d3dr7c1: 3dr7 C:26-371

Lineage for d3dr7c1 (3dr7 C:26-371)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (160 species)
   not a true protein

7. Species Caulobacter crescentus [TaxId:190650] [188372] (3 PDB entries)

8. Domain d3dr7c1: 3dr7 C:26-371 [209270]
   Other proteins in same PDB: d3dr7a2, d3dr7b2, d3dr7c2, d3dr7d2
   automated match to d3bn1c_
   complexed with edo, gpd

Details for d3dr7c1

PDB Entry: 3dr7, 1.7 Å

PDB Description: gdp-perosamine synthase from caulobacter crescentus with bound gdp-3- deoxyperosamine

PDB Compounds: (C:) Putative perosamine synthetase

SCOPe Domain Sequences for d3dr7c1:

Sequence; same for both SEQRES and ATOM records:

>d3dr7c1 c.67.1.0 (C:26-371) automated matches {Caulobacter crescentus [TaxId: 190650]}
mdttwissvgrfivefekafadycgvkhaiacnngttalhlalvamgigpgdevivpslt
yiasansvtycgatpvlvdndprtfnldaaklealitprtkaimpvhlygqicdmdpile
varrhnllviedaaeavgatyrgkksgslgdcatfsffgnkiittgeggmittndddlaa
kmrllrgqgmdpnrrywfpivgfnyrmtniqaaiglaqlervdehlaarervvgwyeqkl
arlgnrvtkphvaltgrhvfwmytvrlgeglsttrdqvikdldalgiesrpvfhpmhimp
pyahlatddlkiaeacgvdglnlpthaglteadidrviaaldqvlv

Timeline for d3dr7c1:

• d3dr7c1 first appeared in SCOPe 2.03, called d3dr7c_
  
• d3dr7c1 appears in SCOPe 2.06
  
• d3dr7c1 appears in the current release, SCOPe 2.08