Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (166 species) not a true protein |
Species Caulobacter crescentus [TaxId:190650] [188372] (3 PDB entries) |
Domain d3dr7c1: 3dr7 C:26-371 [209270] Other proteins in same PDB: d3dr7a2, d3dr7b2, d3dr7c2, d3dr7d2 automated match to d3bn1c_ complexed with edo, gpd |
PDB Entry: 3dr7 (more details), 1.7 Å
SCOPe Domain Sequences for d3dr7c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dr7c1 c.67.1.0 (C:26-371) automated matches {Caulobacter crescentus [TaxId: 190650]} mdttwissvgrfivefekafadycgvkhaiacnngttalhlalvamgigpgdevivpslt yiasansvtycgatpvlvdndprtfnldaaklealitprtkaimpvhlygqicdmdpile varrhnllviedaaeavgatyrgkksgslgdcatfsffgnkiittgeggmittndddlaa kmrllrgqgmdpnrrywfpivgfnyrmtniqaaiglaqlervdehlaarervvgwyeqkl arlgnrvtkphvaltgrhvfwmytvrlgeglsttrdqvikdldalgiesrpvfhpmhimp pyahlatddlkiaeacgvdglnlpthaglteadidrviaaldqvlv
Timeline for d3dr7c1: