SCOP 1.55: Domain d2igfl2: 2igf L:108-214

Lineage for d2igfl2 (2igf L:108-214)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab B13I2 (mouse), kappa L chain [48983] (2 PDB entries)

8. Domain d2igfl2: 2igf L:108-214 [20926]
   Other proteins in same PDB: d2igfh1, d2igfl1

Details for d2igfl2

PDB Entry: 2igf, 2.8 Å

PDB Description: crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 angstroms

SCOP Domain Sequences for d2igfl2:

Sequence; same for both SEQRES and ATOM records:

>d2igfl2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Fab B13I2 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d2igfl2:

• d2igfl2 appears in SCOP 1.57
  
• d2igfl2 appears in the current release, SCOPe 2.08