SCOPe 2.08: Domain d3dphb_: 3dph B:

Lineage for d3dphb_ (3dph B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)

6. Protein HIV capsid protein, dimerisation domain [47359] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47360] (13 PDB entries)

8. Domain d3dphb_: 3dph B: [209255]
   automated match to d1baja_
   mutant

Details for d3dphb_

PDB Entry: 3dph, 2.01 Å

PDB Description: hiv-1 capsid c-terminal domain mutant (l211s)

PDB Compounds: (B:) hiv-1 capsid protein

SCOPe Domain Sequences for d3dphb_:

Sequence; same for both SEQRES and ATOM records:

>d3dphb_ a.28.3.1 (B:) HIV capsid protein, dimerisation domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
ptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalg
pgatseemmtacqgvggpgh

Timeline for d3dphb_:

• d3dphb_ first appeared in SCOPe 2.03
  
• d3dphb_ appears in SCOPe 2.07