Class a: All alpha proteins [46456] (290 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) |
Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins) |
Protein HIV capsid protein, dimerisation domain [47359] (3 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [47360] (13 PDB entries) |
Domain d3dphb_: 3dph B: [209255] automated match to d1baja_ mutant |
PDB Entry: 3dph (more details), 2.01 Å
SCOPe Domain Sequences for d3dphb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dphb_ a.28.3.1 (B:) HIV capsid protein, dimerisation domain {Human immunodeficiency virus type 1 [TaxId: 11676]} ptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalg pgatseemmtacqgvggpgh
Timeline for d3dphb_: