Lineage for d1igfm2 (1igf M:108-214)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221380Species Fab B13I2 (mouse), kappa L chain [48983] (2 PDB entries)
  8. 221384Domain d1igfm2: 1igf M:108-214 [20924]
    Other proteins in same PDB: d1igfh1, d1igfj1, d1igfl1, d1igfm1

Details for d1igfm2

PDB Entry: 1igf (more details), 2.8 Å

PDB Description: crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 angstroms

SCOP Domain Sequences for d1igfm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igfm2 b.1.1.2 (M:108-214) Immunoglobulin (constant domains of L and H chains) {Fab B13I2 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1igfm2:

Click to download the PDB-style file with coordinates for d1igfm2.
(The format of our PDB-style files is described here.)

Timeline for d1igfm2: