Class b: All beta proteins [48724] (180 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.0: automated matches [191365] (1 protein) not a true family |
Protein automated matches [190439] (22 species) not a true protein |
Species Xanthomonas campestris [TaxId:340] [225517] (1 PDB entry) |
Domain d3dmbc_: 3dmb C: [209236] Other proteins in same PDB: d3dmba2 automated match to d2fhqb_ |
PDB Entry: 3dmb (more details), 2.3 Å
SCOPe Domain Sequences for d3dmbc_:
Sequence, based on SEQRES records: (download)
>d3dmbc_ b.45.1.0 (C:) automated matches {Xanthomonas campestris [TaxId: 340]} pkelqdkfwkalksdrtvmlgldgvedgharpmtaqiegdsggpiwfftskdnaliamlg qgrrvigafsskghdlfasisgslredtdpavvdrlwnpyvaawyeggkddpklallrld adhaqiwlngssllagikvllg
>d3dmbc_ b.45.1.0 (C:) automated matches {Xanthomonas campestris [TaxId: 340]} pkelqdkfwkalksdrtvmlgarpmtaqiegdsggpiwfftskdnaliamlgqgrrviga fsskghdlfasisgslredtdpavvdrlwnpyvaawyeggkddpklallrldadhaqiwl ngssllagikvllg
Timeline for d3dmbc_: