SCOPe 2.08: Domain d3dmbc_: 3dmb C:

Lineage for d3dmbc_ (3dmb C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.0: automated matches [191365] (1 protein)
   not a true family

6. Protein automated matches [190439] (22 species)
   not a true protein

7. Species Xanthomonas campestris [TaxId:340] [225517] (1 PDB entry)

8. Domain d3dmbc_: 3dmb C: [209236]
   Other proteins in same PDB: d3dmba2
   automated match to d2fhqb_

Details for d3dmbc_

PDB Entry: 3dmb, 2.3 Å

PDB Description: crystal structure of a putative general stress family protein (xcc2264) from xanthomonas campestris pv. campestris at 2.30 a resolution

PDB Compounds: (C:) Putative General Stress Protein 26 with a PNP-Oxidase like Fold

SCOPe Domain Sequences for d3dmbc_:

Sequence, based on SEQRES records:

>d3dmbc_ b.45.1.0 (C:) automated matches {Xanthomonas campestris [TaxId: 340]}
pkelqdkfwkalksdrtvmlgldgvedgharpmtaqiegdsggpiwfftskdnaliamlg
qgrrvigafsskghdlfasisgslredtdpavvdrlwnpyvaawyeggkddpklallrld
adhaqiwlngssllagikvllg

Sequence, based on observed residues (ATOM records):

>d3dmbc_ b.45.1.0 (C:) automated matches {Xanthomonas campestris [TaxId: 340]}
pkelqdkfwkalksdrtvmlgarpmtaqiegdsggpiwfftskdnaliamlgqgrrviga
fsskghdlfasisgslredtdpavvdrlwnpyvaawyeggkddpklallrldadhaqiwl
ngssllagikvllg

Timeline for d3dmbc_:

• d3dmbc_ first appeared in SCOPe 2.03
  
• d3dmbc_ appears in SCOPe 2.07