Lineage for d3dl2b2 (3dl2 B:319-471)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2999522Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2999523Protein automated matches [226850] (47 species)
    not a true protein
  7. 2999669Species Human (Homo sapiens) [TaxId:9606] [225157] (2 PDB entries)
  8. 2999671Domain d3dl2b2: 3dl2 B:319-471 [209225]
    Other proteins in same PDB: d3dl2a1, d3dl2a3, d3dl2b1, d3dl2b3
    automated match to d1ez4a2
    complexed with na, po4

Details for d3dl2b2

PDB Entry: 3dl2 (more details), 2.1 Å

PDB Description: Hexagonal structure of the LDH domain of Human Ubiquitin-conjugating Enzyme E2-like Isoform A
PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 variant 3

SCOPe Domain Sequences for d3dl2b2:

Sequence, based on SEQRES records: (download)

>d3dl2b2 d.162.1.0 (B:319-471) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cnldsqrlqyiitnvlkaqtsgkevwvigeqgedkvltwsgqeevvshtsqvqlsnrame
llrvkgqrswsvglsvadmvdsivnnkkkvhsvsalakgyydinsevflslpcilgtngv
sevikttlkedtvteklqssassihslqqqlkl

Sequence, based on observed residues (ATOM records): (download)

>d3dl2b2 d.162.1.0 (B:319-471) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cnldsqrlqyiitnvlkaqtkevwvigeqgedkvltwsgqeevvshtsqvqlsnramell
rvkgqrswsvglsvadmvdsivnnkkkvhsvsalakgyydinsevflslpcilgtngvse
viktlkdtvteklqssassihslqqqlkl

SCOPe Domain Coordinates for d3dl2b2:

Click to download the PDB-style file with coordinates for d3dl2b2.
(The format of our PDB-style files is described here.)

Timeline for d3dl2b2: