SCOPe 2.03: Domain d3dl2b1: 3dl2 B:169-318

Lineage for d3dl2b1 (3dl2 B:169-318)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (28 PDB entries)

8. Domain d3dl2b1: 3dl2 B:169-318 [209224]
   Other proteins in same PDB: d3dl2a2, d3dl2b2
   automated match to d1ez4a1
   complexed with na, po4

Details for d3dl2b1

PDB Entry: 3dl2, 2.1 Å

PDB Description: Hexagonal structure of the LDH domain of Human Ubiquitin-conjugating Enzyme E2-like Isoform A

PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 variant 3

SCOPe Domain Sequences for d3dl2b1:

Sequence, based on SEQRES records:

>d3dl2b1 c.2.1.0 (B:169-318) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsskswanhenktvnkitvvgggelgiactlaisakgiadrlvlldlsegtkgatmdlei
fnlpnveiskdlsasahskvviftvnslgssqsyldvvqsnvdmfralvpalghysqhsv
llvasqpveimtyvtwklstfpanrvigig

Sequence, based on observed residues (ATOM records):

>d3dl2b1 c.2.1.0 (B:169-318) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssksvnkitvvgggelgiactlaisakgiadrlvlldlsegtkgatmdleifnlpnvei
skdlsasahskvviftvnsqsyldvvqsnvdmfralvpalghysqhsvllvasqpveimt
yvtwklstfpanrvigig

Timeline for d3dl2b1:

• d3dl2b1 is new in SCOPe 2.03-stable
  
• d3dl2b1 appears in SCOPe 2.04
  
• d3dl2b1 appears in the current release, SCOPe 2.08