SCOPe 2.03: Domain d1dfbh2: 1dfb H:127-229

Lineage for d1dfbh2 (1dfb H:127-229)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (177 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d1dfbh2: 1dfb H:127-229 [20921]
   Other proteins in same PDB: d1dfbh1, d1dfbl1, d1dfbl2
   part of Fab 3D6

Details for d1dfbh2

PDB Entry: 1dfb, 2.7 Å

PDB Description: structure of a human monoclonal antibody fab fragment against gp41 of human immunodeficiency virus type i

PDB Compounds: (H:) igg1-kappa 3d6 fab (heavy chain)

SCOPe Domain Sequences for d1dfbh2:

Sequence; same for both SEQRES and ATOM records:

>d1dfbh2 b.1.1.2 (H:127-229) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Timeline for d1dfbh2:

• d1dfbh2 first appeared (with stable ids) in SCOP 1.55
  
• d1dfbh2 appears in SCOPe 2.02
  
• d1dfbh2 appears in SCOPe 2.04
  
• d1dfbh2 appears in the current release, SCOPe 2.08