Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Legionella pneumophila [TaxId:272624] [225487] (1 PDB entry) |
Domain d3djcj1: 3djc J:2-122 [209200] Other proteins in same PDB: d3djca3, d3djcb3, d3djcc3, d3djcd3, d3djce3, d3djcf3, d3djcg3, d3djch3, d3djci3, d3djcj3, d3djck3, d3djcl3 automated match to d3bexa1 complexed with gol |
PDB Entry: 3djc (more details), 2.4 Å
SCOPe Domain Sequences for d3djcj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3djcj1 c.55.1.0 (J:2-122) automated matches {Legionella pneumophila [TaxId: 272624]} ilcidvgnshiyggvfdgdeiklrfrhtskvstsdelgiflksvlrenncspetirkiai csvvpqvdyslrsacvkyfsidpfllqagvktglnikyrnpvevgadrianaiaathsfp n
Timeline for d3djcj1:
View in 3D Domains from other chains: (mouse over for more information) d3djca1, d3djca2, d3djca3, d3djcb1, d3djcb2, d3djcb3, d3djcc1, d3djcc2, d3djcc3, d3djcd1, d3djcd2, d3djcd3, d3djce1, d3djce2, d3djce3, d3djcf1, d3djcf2, d3djcf3, d3djcg1, d3djcg2, d3djcg3, d3djch1, d3djch2, d3djch3, d3djci1, d3djci2, d3djci3, d3djck1, d3djck2, d3djck3, d3djcl1, d3djcl2, d3djcl3 |