SCOP 1.65: Domain d1dfbl2: 1dfb L:107-212

Lineage for d1dfbl2 (1dfb L:107-212)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (62 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1dfbl2: 1dfb L:107-212 [20920]
   Other proteins in same PDB: d1dfbh1, d1dfbh2, d1dfbl1
   part of Fab 3D6

Details for d1dfbl2

PDB Entry: 1dfb, 2.7 Å

PDB Description: structure of a human monoclonal antibody fab fragment against gp41 of human immunodeficiency virus type i

SCOP Domain Sequences for d1dfbl2:

Sequence; same for both SEQRES and ATOM records:

>d1dfbl2 b.1.1.2 (L:107-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d1dfbl2:

• d1dfbl2 first appeared (with stable ids) in SCOP 1.55
  
• d1dfbl2 appears in SCOP 1.63
  
• d1dfbl2 appears in SCOP 1.67
  
• d1dfbl2 appears in the current release, SCOPe 2.08