Lineage for d2dblh2 (2dbl H:113-228)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289100Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 289192Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)
  8. 289443Domain d2dblh2: 2dbl H:113-228 [20919]
    Other proteins in same PDB: d2dblh1, d2dbll1, d2dbll2
    part of Fab DB3
    complexed with s5h

Details for d2dblh2

PDB Entry: 2dbl (more details), 2.9 Å

PDB Description: molecular basis of cross-reactivity and the limits of antibody-antigen complementarity

SCOP Domain Sequences for d2dblh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dblh2 b.1.1.2 (H:113-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d2dblh2:

Click to download the PDB-style file with coordinates for d2dblh2.
(The format of our PDB-style files is described here.)

Timeline for d2dblh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dblh1