Lineage for d2dblh2 (2dbl H:113-228)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8926Species Fab DB3 (mouse), kappa L chain [48981] (6 PDB entries)
  8. Domain d2dblh2: 2dbl H:113-228 [20919]
    Other proteins in same PDB: d2dblh1, d2dbll1

Details for d2dblh2

PDB Entry: 2dbl (more details), 2.9 Å

PDB Description: molecular basis of cross-reactivity and the limits of antibody-antigen complementarity

SCOP Domain Sequences for d2dblh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dblh2 b.1.1.2 (H:113-228) Immunoglobulin (constant domains of L and H chains) {Fab DB3 (mouse), kappa L chain}
sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d2dblh2 are not available.

Timeline for d2dblh2:

Domains from same chain:
(mouse over for more information)
d2dblh1
Domains from other chains:
(mouse over for more information)
d2dbll1, d2dbll2