SCOPe 2.05: Domain d3dgba1: 3dgb A:4-132

Lineage for d3dgba1 (3dgb A:4-132)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Pseudomonas fluorescens [TaxId:220664] [225446] (3 PDB entries)

8. Domain d3dgba1: 3dgb A:4-132 [209170]
   Other proteins in same PDB: d3dgba2
   automated match to d1f9ca2
   complexed with mg, muc

Details for d3dgba1

PDB Entry: 3dgb, 1.7 Å

PDB Description: crystal structure of muconate lactonizing enzyme from pseudomonas fluorescens complexed with muconolactone

PDB Compounds: (A:) Muconate cycloisomerase

SCOPe Domain Sequences for d3dgba1:

Sequence; same for both SEQRES and ATOM records:

>d3dgba1 d.54.1.0 (A:4-132) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
hasaiesietiivdlptirphklamhtmqnqtlvlirlrcadgieglgesttigglaygn
espdsiktnidrfvaplligqdasninaamlrleqsirgntfaksgiesalldaqgkrlg
lpvsellgg

Timeline for d3dgba1:

• d3dgba1 first appeared in SCOPe 2.03
  
• d3dgba1 appears in SCOPe 2.04
  
• d3dgba1 appears in SCOPe 2.06
  
• d3dgba1 appears in the current release, SCOPe 2.08