SCOPe 2.03: Domain d3dg7c2: 3dg7 C:125-366

Lineage for d3dg7c2 (3dg7 C:125-366)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (45 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [225618] (4 PDB entries)

8. Domain d3dg7c2: 3dg7 C:125-366 [209167]
   Other proteins in same PDB: d3dg7a1, d3dg7b1, d3dg7c1, d3dg7d1
   automated match to d1nu5a1
   complexed with mg, muc

Details for d3dg7c2

PDB Entry: 3dg7, 2 Å

PDB Description: crystal structure of muconate lactonizing enzyme from mucobacterium smegmatis complexed with muconolactone

PDB Compounds: (C:) Muconate cycloisomerase

SCOPe Domain Sequences for d3dg7c2:

Sequence; same for both SEQRES and ATOM records:

>d3dg7c2 c.1.11.0 (C:125-366) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
ytdrmrvshmlgfddpvkmvaeaeriretygintfkvkvgrrpvqldtavvralrerfgd
aielyvdgnrgwsaaeslramremadldllfaeelcpaddvlsrrrlvgqldmpfiades
vptpadvtrevlggsataisiktartgftgstrvhhlaeglgldmvmgnqidgqigtact
vsfgtafertsrhagelsnfldmsddlltvplqisdgqlhrrpgpglgieidpdklahyr
td

Timeline for d3dg7c2:

• d3dg7c2 is new in SCOPe 2.03-stable
  
• d3dg7c2 appears in SCOPe 2.04
  
• d3dg7c2 appears in the current release, SCOPe 2.08