SCOPe 2.03: Domain d3dg6a1: 3dg6 A:1-124

Lineage for d3dg6a1 (3dg6 A:1-124)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (55 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [225617] (4 PDB entries)

8. Domain d3dg6a1: 3dg6 A:1-124 [209160]
   Other proteins in same PDB: d3dg6a2
   automated match to d1nu5a2
   complexed with mg, muc

Details for d3dg6a1

PDB Entry: 3dg6, 1.6 Å

PDB Description: crystal structure of muconate lactonizing enzyme from mucobacterium smegmatis complexed with muconolactone

PDB Compounds: (A:) Muconate cycloisomerase

SCOPe Domain Sequences for d3dg6a1:

Sequence; same for both SEQRES and ATOM records:

>d3dg6a1 d.54.1.0 (A:1-124) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mkivaigaipfsipytkplrfasgevhaaehvlvrvhtddgivgvaeapprpftygetqt
givavieqyfapaligltlterevahtrmartvgnptakaaidmamwdalgqslrlsvse
mlgg

Timeline for d3dg6a1:

• d3dg6a1 is new in SCOPe 2.03-stable
  
• d3dg6a1 appears in SCOPe 2.04
  
• d3dg6a1 appears in the current release, SCOPe 2.08