SCOPe 2.06: Domain d3dfya1: 3dfy A:3-124

Lineage for d3dfya1 (3dfy A:3-124)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (88 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [225439] (5 PDB entries)

8. Domain d3dfya1: 3dfy A:3-124 [209126]
   Other proteins in same PDB: d3dfya2, d3dfyb2, d3dfyc2, d3dfyd2, d3dfye2, d3dfyf2, d3dfyg2, d3dfyh2, d3dfyi2, d3dfyj2, d3dfyk2, d3dfyl2, d3dfym2, d3dfyn2, d3dfyo2, d3dfyp2
   automated match to d1jpma2
   complexed with mg

Details for d3dfya1

PDB Entry: 3dfy, 2.1 Å

PDB Description: Crystal structure of apo dipeptide epimerase from Thermotoga maritima

PDB Compounds: (A:) Muconate cycloisomerase

SCOPe Domain Sequences for d3dfya1:

Sequence; same for both SEQRES and ATOM records:

>d3dfya1 d.54.1.0 (A:3-124) automated matches {Thermotoga maritima [TaxId: 243274]}
rivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngervea
llaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyll
gg

Timeline for d3dfya1:

• d3dfya1 first appeared in SCOPe 2.03
  
• d3dfya1 appears in SCOPe 2.05
  
• d3dfya1 appears in SCOPe 2.07
  
• d3dfya1 appears in the current release, SCOPe 2.08