Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (59 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [225440] (5 PDB entries) |
Domain d3derd2: 3der D:125-343 [209112] Other proteins in same PDB: d3dera1, d3derb1, d3derc1, d3derd1 automated match to d1jpma1 complexed with ala, mg |
PDB Entry: 3der (more details), 1.9 Å
SCOPe Domain Sequences for d3derd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3derd2 c.1.11.0 (D:125-343) automated matches {Thermotoga maritima [TaxId: 243274]} krdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrgak yivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaadesa rtkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginqsv hfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvk
Timeline for d3derd2: