SCOP 1.61: Domain d1dbjh2: 1dbj H:113-228

Lineage for d1dbjh2 (1dbj H:113-228)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab DB3 (mouse), kappa L chain [48981] (6 PDB entries)

8. Domain d1dbjh2: 1dbj H:113-228 [20911]
   Other proteins in same PDB: d1dbjh1, d1dbjl1

Details for d1dbjh2

PDB Entry: 1dbj, 2.7 Å

PDB Description: molecular basis of cross-reactivity and the limits of antibody-antigen complementarity

SCOP Domain Sequences for d1dbjh2:

Sequence; same for both SEQRES and ATOM records:

>d1dbjh2 b.1.1.2 (H:113-228) Immunoglobulin (constant domains of L and H chains) {Fab DB3 (mouse), kappa L chain}
sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr

Timeline for d1dbjh2:

• d1dbjh2 first appeared (with stable ids) in SCOP 1.55
  
• d1dbjh2 appears in SCOP 1.59
  
• d1dbjh2 appears in SCOP 1.63
  
• d1dbjh2 appears in the current release, SCOPe 2.08