Lineage for d3deqb1 (3deq B:3-124)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412983Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1412984Protein automated matches [226922] (55 species)
    not a true protein
  7. 1413299Species Thermotoga maritima [TaxId:243274] [225439] (5 PDB entries)
  8. 1413309Domain d3deqb1: 3deq B:3-124 [209099]
    Other proteins in same PDB: d3deqa2, d3deqb2, d3deqc2, d3deqd2
    automated match to d1jpma2
    complexed with ala, mg

Details for d3deqb1

PDB Entry: 3deq (more details), 2.1 Å

PDB Description: Crystal structure of dipeptide epimerase from Thermotoga maritima complexed with L-Ala-L-Leu dipeptide
PDB Compounds: (B:) Muconate cycloisomerase

SCOPe Domain Sequences for d3deqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3deqb1 d.54.1.0 (B:3-124) automated matches {Thermotoga maritima [TaxId: 243274]}
rivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngervea
llaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyll
gg

SCOPe Domain Coordinates for d3deqb1:

Click to download the PDB-style file with coordinates for d3deqb1.
(The format of our PDB-style files is described here.)

Timeline for d3deqb1: