Lineage for d3ddua2 (3ddu A:431-710)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900173Family c.69.1.4: Prolyl oligopeptidase, C-terminal domain [53496] (2 proteins)
    N-terminal domain is a 7-bladed beta-propeller
    automatically mapped to Pfam PF00326
  6. 2900206Protein automated matches [226978] (1 species)
    not a true protein
  7. 2900207Species Human (Homo sapiens) [TaxId:9606] [225502] (1 PDB entry)
  8. 2900208Domain d3ddua2: 3ddu A:431-710 [209096]
    Other proteins in same PDB: d3ddua1
    automated match to d1e5ta2
    complexed with 552, act, gol

Details for d3ddua2

PDB Entry: 3ddu (more details), 1.56 Å

PDB Description: prolyl oligopeptidase with gsk552
PDB Compounds: (A:) prolyl endopeptidase

SCOPe Domain Sequences for d3ddua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ddua2 c.69.1.4 (A:431-710) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisitpnysvsrli
fvrhmggilavanirgggeygetwhkggilankqncfddfqcaaeylikegytspkrlti
nggsnggllvaacanqrpdlfgcviaqvgvmdmlkfhkytighawttdygcsdskqhfew
lvkysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyivgrsrkqnnpl
lihvdtkaghgagkptakvieevsdmfafiarclnvdwip

SCOPe Domain Coordinates for d3ddua2:

Click to download the PDB-style file with coordinates for d3ddua2.
(The format of our PDB-style files is described here.)

Timeline for d3ddua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ddua1