Class a: All alpha proteins [46456] (286 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (31 species) not a true protein |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225668] (3 PDB entries) |
Domain d3dc6c1: 3dc6 C:0-85 [209086] Other proteins in same PDB: d3dc6a2, d3dc6c2 automated match to d1bsma1 complexed with mn, so4 |
PDB Entry: 3dc6 (more details), 1.8 Å
SCOPe Domain Sequences for d3dc6c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dc6c1 a.2.11.0 (C:0-85) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} mkhslpdlpydyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnvkeaia lqpalkfnggghinhsifwtnlakdg
Timeline for d3dc6c1: