SCOPe 2.08: Domain d3dc0a1: 3dc0 A:4-347

Lineage for d3dc0a1 (3dc0 A:4-347)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (31 species)
   not a true protein

7. Species Bacillus sp. [TaxId:535911] [225472] (1 PDB entry)

8. Domain d3dc0a1: 3dc0 A:4-347 [209069]
   Other proteins in same PDB: d3dc0a2
   automated match to d1baga2
   complexed with ca

Details for d3dc0a1

PDB Entry: 3dc0, 2.78 Å

PDB Description: Crystal structure of native alpha-amylase from Bacillus sp. KR-8104

PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d3dc0a1:

Sequence; same for both SEQRES and ATOM records:

>d3dc0a1 c.1.8.1 (A:4-347) automated matches {Bacillus sp. [TaxId: 535911]}
psiksgtilhawnwsfntlknnmkdihdagytaiqtspinqvkegnkgdksmgnwywlyq
ptsyqignrylgseeefkemcaaaeeygvkvivdavinhttsdyaaisneiksisnwthg
ntqiknwsdrwdvtqnsllglydwntqntqvqsylkrfleralndgadgfrydaakhiel
pddgnygsqfwpnitntsaefqygeilqdsasrdaayanymnvtasnyghsirsalknrn
lsvsnishyasdvsadklvtwveshdtyanddeestwmsdddirlgwaviasrsgstplf
fsrpdgggngvrfpgktqigdrgsalfedqaivavntfhnvmag

Timeline for d3dc0a1:

• d3dc0a1 first appeared in SCOPe 2.03
  
• d3dc0a1 appears in SCOPe 2.07